PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010910356.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 327aa    MW: 35981.9 Da    PI: 5.2657
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010910356.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM84.12.8e-26371641128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka....eekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                     lp+G+rF+P+  el+ eyL+ kveg++ + + vi++vd+y + P++L  +v      +  +++fF++ +++  +g+ + r+t +g Wk+t k ++
  XP_010910356.1  37 LPRGYRFDPKPWELI-EYLQDKVEGRPDDGQGVINDVDVYGCSPKQLVDMVGDlipcDGGSLFFFTSIEHR--NGNCRDRSTPDGHWKSTKKMTR 128
                     799************.**************99***************743333344366688999988775..6889999*************** PP

             NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     + + +g+lvg ++ L +++g+++ +e+t+W+m+e  l
  XP_010910356.1 129 IRNGEGRLVGYRQDLCYFHGKKK-PERTEWLMKEHIL 164
                     ******************88665.48*******9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.1E-2633177IPR003441NAC domain
PROSITE profilePS5100528.20337179IPR003441NAC domain
PfamPF023655.6E-1338162IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MGMGTRPGEV VERRGAIYGG DGGGGREREG KVPVMRLPRG YRFDPKPWEL IEYLQDKVEG  60
RPDDGQGVIN DVDVYGCSPK QLVDMVGDLI PCDGGSLFFF TSIEHRNGNC RDRSTPDGHW  120
KSTKKMTRIR NGEGRLVGYR QDLCYFHGKK KPERTEWLMK EHILDHQQPK MALCEIYSAQ  180
KKCKGQIQGN EWRIQPLKDP TDSESENTQH HYSSNDWSSL GNGTEQRAGP SGGGFLSSSE  240
GFPSAPGTSA GYLSASDGYT WCNSAVDVSD LAQDSLDLYA PPALDVPSQE SPTVHADAAF  300
KEGGSAKAAA HPDMLPDINA PEMWLEN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010910356.10.0PREDICTED: uncharacterized protein LOC105036290
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2941924
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.12e-16NAC domain containing protein 28